PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G16610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 198aa    MW: 22423.3 Da    PI: 6.8061
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G16610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.31.4e-07551031462
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      R +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ + ++
  OBART10G16610.1  55 RQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 103
                      89**********************************9999887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-947106IPR004827Basic-leucine zipper domain
CDDcd147031.69E-144896No hitNo description
SuperFamilySSF579593.86E-75596No hitNo description
Gene3DG3DSA:1.20.5.1707.0E-855102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MDSLMGKLSF AANGEPAKFS LEFGSGDFTP AEMKRIMADE KLAEMALADP KRVKRQSAAR  60
SKERRMRYIA ELEQKVQILQ TEATTLSAQL TLLQRDSSGM ATQNNELKFR LQSMEQQAQL  120
RDALNEALTA EVQRLKLAAN EVGDTSSSSN LAHQIQLRCQ NQMLDLHKQQ QQQVEQIPFY  180
QLEQPEQQNG TARNHESK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086070.0AK108607.1 Oryza sativa Japonica Group cDNA clone:002-146-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.11e-130PREDICTED: transcription factor RF2a-like
SwissprotQ69IL46e-45RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A0D3HFX61e-143A0A0D3HFX6_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g38820.11e-129(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-47bZIP family protein